- Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-49128
- 0.1 ml (also 25ul)
- Immunocytochemistry/ Immunofluorescence
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- Nicotinic Acetylcholine R alpha 5/CHRNA5
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: AQRGLSEPSS IAKHEDSLLK DLFQDYERWV RPVEHLNDK
- cholinergic receptor nicotinic alpha 5 subunit
- LNCR2
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDK
Specifications/Features
Available conjugates: Unconjugated